PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G31840.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 341aa    MW: 37444 Da    PI: 4.4431
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G31840.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.51.4e-2075128356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  OGLUM02G31840.2  75 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 128
                      5678*************************************************9 PP

2HD-ZIP_I/II132.61.5e-4274166193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk+++dal++++++L +++++L++++++
  OGLUM02G31840.2  74 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDALLQDNHRLHSQVMS 166
                      69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-2069132IPR009057Homeodomain-like
PROSITE profilePS5007118.2270130IPR001356Homeobox domain
SMARTSM003892.0E-2073134IPR001356Homeobox domain
CDDcd000861.06E-2075131No hitNo description
PfamPF000468.2E-1875128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.9E-2276137IPR009057Homeodomain-like
PRINTSPR000312.2E-6101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000312.2E-6110126IPR000047Helix-turn-helix motif
PfamPF021831.8E-18130172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MESGRLIFST AGSGAGQMLF LDCGAGGGGG GAMFHRGARP VLGMEEGGRG VKRPFFTTPD  60
ELLEEEYYDE QLPEKKRRLT PEQVHLLERS FEEENKLEPE RKTELARKLG LQPRQVAVWF  120
QNRRARWKTK QLERDFDRLK ASFDALRADH DALLQDNHRL HSQVMSLTEK LQEKETTTEG  180
SAGGAVDVPG LPAAADVKVA VPDAEEPALE EAAAAFEEQQ EQQVKAEDRL STGSGGSAVV  240
DTDAQLVVGC GRQHLAAVDS SVESYFPGGD EYHDCVMGPM DHAAGGIQSE EDDGAGSDEG  300
CSYYADDAGV LFADHGHHHH HQHADDDEED GQQISCWWMW N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8331530.0CT833153.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI226L23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626254.10.0PREDICTED: homeobox-leucine zipper protein HOX16 isoform X2
SwissprotQ6YWR40.0HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLA0A0D9YXS10.0A0A0D9YXS1_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g49700.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-58homeobox 1